VN1R5 Peptide - middle region
VN1R5 Peptide - middle region
Product Specifications
Product Name Alternative
V1RL5
UniProt
Q7Z5H4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VN1R5 Rabbit Polyclonal Antibody (orb587796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_776257.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AINSSTRLGSGGTQDDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15175049 1 Vial
Lentiviral mouse Tmem69 shRNA (UAS) - Lentiviral mouse Tmem69 shRNA (UAS) (25)
Sign In for Pricing
View Details 
GTR15372480 1 Vial
Lentiviral human VBP1 sgRNA gene knockout kit - Lentiviral human VBP1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 