Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VN1R5 Peptide - middle region

VN1R5 Peptide - middle region

Product Specifications

Product Name Alternative

V1RL5

UniProt

Q7Z5H4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VN1R5 Rabbit Polyclonal Antibody (orb587796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776257.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AINSSTRLGSGGTQDDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIS1 Peptide
abx269167 100 µg

LIS1 Peptide

Sign In for Pricing
View Details
Gramicidin
C02309-25mg 25 mg

Gramicidin

Sign In for Pricing
View Details
Arg1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3844204 1.0 µg DNA

Arg1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MRGPRX3 Antibody (N-term)
E45M06484G-1 100 µL

MRGPRX3 Antibody (N-term)

Sign In for Pricing
View Details
Anti-SNX21 Antibody
MBS8323326-01 0.03 mL

Anti-SNX21 Antibody

Sign In for Pricing
View Details
Anti-SNX21 Antibody
MBS8323326-02 0.05 mL

Anti-SNX21 Antibody

Sign In for Pricing
View Details