Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY2R Peptide - N-terminal region

NPY2R Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPY2-R

UniProt

P49146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY2R Rabbit Polyclonal Antibody (orb573679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000901

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 S2 Protein (mFc Tag)
PKSR030516 100 µg

Recombinant SARS-CoV-2 S2 Protein (mFc Tag)

Sign In for Pricing
View Details
2-(2-Hydroxyphenyl)-4H-1,3-benzoxazin-4-one
TRC-H951240-250MG 250 mg

2-(2-Hydroxyphenyl)-4H-1,3-benzoxazin-4-one

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (rCNN1/832), 0.2mg/mL
BNUB1866-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker) (rCNN1/832), 0.2mg/mL

Sign In for Pricing
View Details
PLAAT3 Antibody (Biotin)
KB-8194-01 50 μL

PLAAT3 Antibody (Biotin)

Sign In for Pricing
View Details
PLAAT3 Antibody (Biotin)
KB-8194-02 100 µL

PLAAT3 Antibody (Biotin)

Sign In for Pricing
View Details
PLAAT3 Antibody (Biotin)
KB-8194-03 1 mL

PLAAT3 Antibody (Biotin)

Sign In for Pricing
View Details