Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY2R Peptide - N-terminal region

NPY2R Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPY2-R

UniProt

P49146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY2R Rabbit Polyclonal Antibody (orb573679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000901

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (B-Cell Marker) (LLC/3778R), CF740 conjugate, 0.1mg/mL
BNC743778-100 1x 100 µL

Human Lambda Light Chain (B-Cell Marker) (LLC/3778R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dibenzo[a,i]pyrene-d14
TRC-D416987-25MG 25 mg

Dibenzo[a,i]pyrene-d14

Sign In for Pricing
View Details
7-Hydroxy-furo[3,4-b]pyrazin-5-one, 70%
TRC-H942520-2.5MG 2.5 mg

7-Hydroxy-furo[3,4-b]pyrazin-5-one, 70%

Sign In for Pricing
View Details
Palladium (5% on Alumina Powder, Reduced, Dry)
TRC-P141045-1G 1 g

Palladium (5% on Alumina Powder, Reduced, Dry)

Sign In for Pricing
View Details
6-Acrylamidohexanoic Acid
TRC-A191323-50MG 50 mg

6-Acrylamidohexanoic Acid

Sign In for Pricing
View Details
p-Nitrophenyl a-D-Glucopyranoside
TRC-N503650-500MG 500 mg

p-Nitrophenyl a-D-Glucopyranoside

Sign In for Pricing
View Details