Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB2 Peptide - N-terminal region

NFKB2 Peptide - N-terminal region

Product Specifications

UniProt

Q00653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFKB2 Rabbit Polyclonal Antibody (orb573701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IITR01324 (Standard)
HY-Y1826R-01 10 mg

IITR01324 (Standard)

Sign In for Pricing
View Details
IITR01324 (Standard)
HY-Y1826R-02 50 mg

IITR01324 (Standard)

Sign In for Pricing
View Details
IITR01324 (Standard)
HY-Y1826R-03 100 mg

IITR01324 (Standard)

Sign In for Pricing
View Details
IITR01324 (Standard)
HY-Y1826R-04 250 mg

IITR01324 (Standard)

Sign In for Pricing
View Details
IITR01324 (Standard)
HY-Y1826R-05 500 mg

IITR01324 (Standard)

Sign In for Pricing
View Details
Fibulin-3 (mab3-5) : m-IgG1 BP-HRP Bundle
sc-532085 1 Kit

Fibulin-3 (mab3-5) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details