Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB2 Peptide - N-terminal region

NFKB2 Peptide - N-terminal region

Product Specifications

UniProt

Q00653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFKB2 Rabbit Polyclonal Antibody (orb573701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRFN3 Rabbit Polyclonal Antibody (Cy5)
orb871592 100 µL

LRFN3 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Isoastragaloside II
orb1301316-01 1 mg

Isoastragaloside II

Sign In for Pricing
View Details
Isoastragaloside II
orb1301316-02 5 mg

Isoastragaloside II

Sign In for Pricing
View Details
Isoastragaloside II
orb1301316-03 10 mg

Isoastragaloside II

Sign In for Pricing
View Details
Isoastragaloside II
orb1301316-04 1 ml x 10 mM (in DMSO)

Isoastragaloside II

Sign In for Pricing
View Details
Isoastragaloside II
orb1301316-05 25 mg

Isoastragaloside II

Sign In for Pricing
View Details