Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF883 Peptide - C-terminal region

ZNF883 Peptide - C-terminal region

Product Specifications

UniProt

P0CG24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF883 Rabbit Polyclonal Antibody (orb573878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094808

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCHSTSLIRHQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SHARP1 (BHLHE41) activation kit by CRISPRa
GA112432 1 Kit

Human SHARP1 (BHLHE41) activation kit by CRISPRa

Sign In for Pricing
View Details
CD71 (DF1513), CF594 conjugate, 0.1mg/mL
BNC940188-100 1x 100 µL

CD71 (DF1513), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF323 (ZSCAN31) (NM_030899) Human Recombinant Protein
TP303342L 1 mg

ZNF323 (ZSCAN31) (NM_030899) Human Recombinant Protein

Sign In for Pricing
View Details
CD105 (ENG) Human Knockdown Lysate
LY300157 100 µg

CD105 (ENG) Human Knockdown Lysate

Sign In for Pricing
View Details
(S)-(-)-Dropropizine
TRC-D681500-1G 1 g

(S)-(-)-Dropropizine

Sign In for Pricing
View Details
MYH (MUTYH) (NM_001048173) Human Recombinant Protein
TP761725 50 µg

MYH (MUTYH) (NM_001048173) Human Recombinant Protein

Sign In for Pricing
View Details