Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF883 Peptide - C-terminal region

ZNF883 Peptide - C-terminal region

Product Specifications

UniProt

P0CG24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF883 Rabbit Polyclonal Antibody (orb573878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094808

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCHSTSLIRHQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (JCB117), Biotin conjugate, 0.1mg/mL
BNCB0476-100 1x 100 µL

CD79a (JCB117), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Snrnp40 Mouse Gene Knockout Kit (CRISPR)
KN516397 1 Kit

Snrnp40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4'-Bromovalerophenone-d9
TRC-B689027-50MG 50 mg

4'-Bromovalerophenone-d9

Sign In for Pricing
View Details
CB 13
TRC-C227068-5MG 5 mg

CB 13

Sign In for Pricing
View Details
Caffeine
TRC-C080100-5G 5 g

Caffeine

Sign In for Pricing
View Details
Human KRTAP4-3 activation kit by CRISPRa
GA113840 1 Kit

Human KRTAP4-3 activation kit by CRISPRa

Sign In for Pricing
View Details