Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PER3 Peptide - C-terminal region

PER3 Peptide - C-terminal region

Product Specifications

UniProt

P56645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PER3 Rabbit Polyclonal Antibody (orb575146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SHQ1 Pre-designed siRNA Set B
SI014757B 1 Each

Human SHQ1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RGD1306008 Protein Vector (Rat) (pPM-C-His)
PV299229 500 ng

RGD1306008 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Cystatin-B Human Protein
AR03002PU-S 100 µg

Cystatin-B Human Protein

Sign In for Pricing
View Details
Umifenovir, Antiviral agent
TBI4472-10MG 10 mg

Umifenovir, Antiviral agent

Sign In for Pricing
View Details
RPL21P100 AAV Vector (Human) (CMV)
40976101 1 µg

RPL21P100 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human ROR1 Antibody , PerCP
E55A09605 50 Tests

Human ROR1 Antibody , PerCP

Sign In for Pricing
View Details