Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PER3 Peptide - C-terminal region

PER3 Peptide - C-terminal region

Product Specifications

UniProt

P56645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PER3 Rabbit Polyclonal Antibody (orb575146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam116b siRNA Oligos set (Rat)
19728176 3x 5 nmol

Fam116b siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human Mesothelin (MSLN) (NM_013404) AAV Particle
RC219757A1V 250 µL

Human Mesothelin (MSLN) (NM_013404) AAV Particle

Sign In for Pricing
View Details
Nano-Tag (9) Mouse mAb, Cy5.5 conjugated
orb1082550 100 µL

Nano-Tag (9) Mouse mAb, Cy5.5 conjugated

Sign In for Pricing
View Details
Anticancer agent 43
C8452-50 50 mg

Anticancer agent 43

Sign In for Pricing
View Details
Rabbit Polyclonal CXCR4 Antibody - Azide Free
NBP2-24862 0.1 mg

Rabbit Polyclonal CXCR4 Antibody - Azide Free

Sign In for Pricing
View Details
OR6A2 Rabbit Polyclonal Antibody (Biotin)
orb451067 100 µL

OR6A2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details