Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM11 Peptide - C-terminal region

PRDM11 Peptide - C-terminal region

Product Specifications

UniProt

Q9NQV5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM11 Rabbit Polyclonal Antibody (orb324560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243625

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV684925 1.0 µg DNA

SLC16A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BCL2L1 Antibody
A48048-50UL 50 μL

BCL2L1 Antibody

Sign In for Pricing
View Details
OPN1SW (1B10) : m-IgG2b BP-HRP Bundle
sc-549548 1 Kit

OPN1SW (1B10) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
Rsph3b-set siRNA/shRNA/RNAi Lentivector (Mouse)
42794094 4x 500 ng

Rsph3b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Human COG1, GST-tagged
COG1-11417H 25 µg

Recombinant Human COG1, GST-tagged

Sign In for Pricing
View Details
Lentiviral mouse Plxnb2 shRNA (UAS) - Lentiviral mouse Plxnb2 shRNA (UAS, iRFP) (25)
GTR15261530 1 Vial

Lentiviral mouse Plxnb2 shRNA (UAS) - Lentiviral mouse Plxnb2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details