Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM11 Peptide - C-terminal region

PRDM11 Peptide - C-terminal region

Product Specifications

UniProt

Q9NQV5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM11 Rabbit Polyclonal Antibody (orb324560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243625

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP23 Peptide
DF15348-BP 1 mg

DUSP23 Peptide

Sign In for Pricing
View Details
Goat Choline-Phosphate Cytidylyltransferase A (PCYT1A) ELISA Kit
MBS9926060 Inquire

Goat Choline-Phosphate Cytidylyltransferase A (PCYT1A) ELISA Kit

Sign In for Pricing
View Details
1-Benzyl-3-phenylpyrrolidin-3-ol
YAA77198-01 50 mg

1-Benzyl-3-phenylpyrrolidin-3-ol

Sign In for Pricing
View Details
1-Benzyl-3-phenylpyrrolidin-3-ol
YAA77198-02 0.5 g

1-Benzyl-3-phenylpyrrolidin-3-ol

Sign In for Pricing
View Details
Anti-human IL-21 mAb (MT216G), unconjugated
3540-1-250 250 µg

Anti-human IL-21 mAb (MT216G), unconjugated

Sign In for Pricing
View Details
Eukaryotic Tetraspanin 30 Cluster of Differentiation 63 (CD63), Recombinant, Human, His-Tag
058164-01 10 µg

Eukaryotic Tetraspanin 30 Cluster of Differentiation 63 (CD63), Recombinant, Human, His-Tag

Sign In for Pricing
View Details