SCML4 Peptide - C-terminal region
SCML4 Peptide - C-terminal region
Product Specifications
UniProt
Q8N228
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCML4 Rabbit Polyclonal Antibody (orb576916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EDVVWFVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGP
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-61037R-Biotin-01 20 µL
PDGF Receptor beta Recombinant Antibody, Biotin Conjugated
Sign In for Pricing
View Details 
bsm-61037R-Biotin-02 100 µL
PDGF Receptor beta Recombinant Antibody, Biotin Conjugated
Sign In for Pricing
View Details C12359 100 µL
Gab 1 (Phospho-Tyr659) Polyclonal Polyclonal Conjugated Antibody
Sign In for Pricing
View Details 