Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCML4 Peptide - C-terminal region

SCML4 Peptide - C-terminal region

Product Specifications

UniProt

Q8N228

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCML4 Rabbit Polyclonal Antibody (orb576916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDVVWFVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGP

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOA2 Peptide - N-terminal region
MBS3236700-01 0.1 mg

APOA2 Peptide - N-terminal region

Sign In for Pricing
View Details
APOA2 Peptide - N-terminal region
MBS3236700-02 5x 0.1 mg

APOA2 Peptide - N-terminal region

Sign In for Pricing
View Details
Human IL-21 R Recombinant Protein
PROTQ9HBE5-50ug 50 µg

Human IL-21 R Recombinant Protein

Sign In for Pricing
View Details
DPT-set siRNA/shRNA/RNAi Lentivector (Human)
18566091 4x 500 ng

DPT-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CDH22 Antibody - N-terminal region
ARP49648_T100-25UL 25 µL

CDH22 Antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Il5 / Interleukin-5 Recombinant Protein
R0078m 1 Each

Mouse Il5 / Interleukin-5 Recombinant Protein

Sign In for Pricing
View Details