Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E3 Peptide - C-terminal region

NR2E3 Peptide - C-terminal region

Product Specifications

UniProt

Q8IVZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR2E3 Rabbit Polyclonal Antibody (orb576950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Guanidoacetic Acid ELISA kit
GTR10399476 96 Well

Guinea Pig Guanidoacetic Acid ELISA kit

Sign In for Pricing
View Details
Mog-2 Antibody
orb801835 2 mg

Mog-2 Antibody

Sign In for Pricing
View Details
GPI Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-10419R-BF555 100 µL

GPI Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (FITC) discontinued
036755-FITC 200 µL

Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (FITC) discontinued

Sign In for Pricing
View Details
RABL2B (Rab-like Protein 2B, FLJ93981, FLJ98216) (AP)
MBS6391792-01 0.1 mL

RABL2B (Rab-like Protein 2B, FLJ93981, FLJ98216) (AP)

Sign In for Pricing
View Details
RABL2B (Rab-like Protein 2B, FLJ93981, FLJ98216) (AP)
MBS6391792-02 5x 0.1 mL

RABL2B (Rab-like Protein 2B, FLJ93981, FLJ98216) (AP)

Sign In for Pricing
View Details