Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E3 Peptide - C-terminal region

NR2E3 Peptide - C-terminal region

Product Specifications

UniProt

Q8IVZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR2E3 Rabbit Polyclonal Antibody (orb576950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP7 Rabbit Monoclonal Antibody [Clone ID: 23GB2250]
TA425317S 20 µL

USP7 Rabbit Monoclonal Antibody [Clone ID: 23GB2250]

Sign In for Pricing
View Details
PPAR a protein
MBS8526806-01 0.02 mg

PPAR a protein

Sign In for Pricing
View Details
PPAR a protein
MBS8526806-02 5x 0.02 mg

PPAR a protein

Sign In for Pricing
View Details
HIVEP1 Double Nickase Plasmid (m2)
sc-431027-NIC-2 20 µg

HIVEP1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Human Sialidase-3 (NEU3) ELISA Kit
AE60337HU-01 48 Tests

Human Sialidase-3 (NEU3) ELISA Kit

Sign In for Pricing
View Details
Human Sialidase-3 (NEU3) ELISA Kit
AE60337HU-02 96 Tests

Human Sialidase-3 (NEU3) ELISA Kit

Sign In for Pricing
View Details