Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4A22 Peptide - N-terminal region

CYP4A22 Peptide - N-terminal region

Product Specifications

UniProt

Q5TCH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP4A22 Rabbit Polyclonal Antibody (orb578227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4R3me2s (H4, H4/n, H4F2, H4FN, FO108, HIST2H4) (MaxLight 550)
MBS6420860-01 0.1 mL

Histone H4R3me2s (H4, H4/n, H4F2, H4FN, FO108, HIST2H4) (MaxLight 550)

Sign In for Pricing
View Details
Histone H4R3me2s (H4, H4/n, H4F2, H4FN, FO108, HIST2H4) (MaxLight 550)
MBS6420860-02 5x 0.1 mL

Histone H4R3me2s (H4, H4/n, H4F2, H4FN, FO108, HIST2H4) (MaxLight 550)

Sign In for Pricing
View Details
pCDNA3.1-NAP1L3 Plasmid
PVT30366 2 µg

pCDNA3.1-NAP1L3 Plasmid

Sign In for Pricing
View Details
Grm8 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7625703 1.0 µg DNA

Grm8 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Mouse SEZ6 Protein
orb2992938-01 10 µg

Recombinant Mouse SEZ6 Protein

Sign In for Pricing
View Details
Recombinant Mouse SEZ6 Protein
orb2992938-02 50 µg

Recombinant Mouse SEZ6 Protein

Sign In for Pricing
View Details