Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4A22 Peptide - N-terminal region

CYP4A22 Peptide - N-terminal region

Product Specifications

UniProt

Q5TCH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP4A22 Rabbit Polyclonal Antibody (orb578227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit
MBS2903969-01 48 Well

Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit

Sign In for Pricing
View Details
Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit
MBS2903969-02 96 Well

Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit

Sign In for Pricing
View Details
Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit
MBS2903969-03 5x 96 Well

Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit

Sign In for Pricing
View Details
Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit
MBS2903969-04 10x 96 Well

Mouse Gpx5/Epididymal secretory glutathione peroxidase ELISA Kit

Sign In for Pricing
View Details
CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (Biotin)
124914-Biotin 100 µL

CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (Biotin)

Sign In for Pricing
View Details
Recombinant Clostridium Novyi rpsP Protein (aa 1-85)
VAng-Lsx00157-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Novyi rpsP Protein (aa 1-85)

Sign In for Pricing
View Details