Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARDH Peptide - C-terminal region

SARDH Peptide - C-terminal region

Product Specifications

UniProt

Q5SYV2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SARDH Rabbit Polyclonal Antibody (orb578438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SESN3 (Sestrin 3) ELISA Kit
MBS8804265-01 48 Well

Human SESN3 (Sestrin 3) ELISA Kit

Sign In for Pricing
View Details
Human SESN3 (Sestrin 3) ELISA Kit
MBS8804265-02 96 Well

Human SESN3 (Sestrin 3) ELISA Kit

Sign In for Pricing
View Details
Human SESN3 (Sestrin 3) ELISA Kit
MBS8804265-03 5x 96 Well

Human SESN3 (Sestrin 3) ELISA Kit

Sign In for Pricing
View Details
Human SESN3 (Sestrin 3) ELISA Kit
MBS8804265-04 10x 96 Well

Human SESN3 (Sestrin 3) ELISA Kit

Sign In for Pricing
View Details
Anti-CRTR1 Antibody
bs-70865R 100 µL

Anti-CRTR1 Antibody

Sign In for Pricing
View Details
Endomorphin 1 Peptide
350158 5 mg

Endomorphin 1 Peptide

Sign In for Pricing
View Details