Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARDH Peptide - C-terminal region

SARDH Peptide - C-terminal region

Product Specifications

UniProt

Q5SYV2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SARDH Rabbit Polyclonal Antibody (orb578438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METAP1D Protein Lysate
OCOA03921-20UG 20 µg

METAP1D Protein Lysate

Sign In for Pricing
View Details
Lentiviral human ATP2B1 shRNA (UAS) - Lentiviral human ATP2B1 shRNA (UAS, GFP) plasmid
GTR15079654 1 Vial

Lentiviral human ATP2B1 shRNA (UAS) - Lentiviral human ATP2B1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human FSHB shRNA (UAS) - Lentiviral human FSHB shRNA (UAS, GFP) plasmid
GTR15128278 1 Vial

Lentiviral human FSHB shRNA (UAS) - Lentiviral human FSHB shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (MaxLight 550)
MBS6216605-01 0.1 mL

DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (MaxLight 550)

Sign In for Pricing
View Details
DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (MaxLight 550)
MBS6216605-02 5x 0.1 mL

DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (MaxLight 550)

Sign In for Pricing
View Details
Benzobicyclon
T14531-01 2 mg

Benzobicyclon

Sign In for Pricing
View Details