Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP2 Peptide - N-terminal region

OSBP2 Peptide - N-terminal region

Product Specifications

UniProt

Q8NA37

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSBP2 Rabbit Polyclonal Antibody (orb325031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZH2 (NM_004456) Human Over-expression Lysate
LY401416 100 µg

EZH2 (NM_004456) Human Over-expression Lysate

Sign In for Pricing
View Details
Prohibitin (PHB) Human Gene Knockout Kit (CRISPR)
KN201229RB 1 Kit

Prohibitin (PHB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]
TA501655AM 100 µL

PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]

Sign In for Pricing
View Details
NMBR (NM_002511) Human Over-expression Lysate
LY400899 100 µg

NMBR (NM_002511) Human Over-expression Lysate

Sign In for Pricing
View Details
Aurora A (AURKA) (N-term) Rabbit Polyclonal Antibody
AP14756PU-N 400 µL

Aurora A (AURKA) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXP4 Antibody
KC-3941-01 50 μL

FOXP4 Antibody

Sign In for Pricing
View Details