SLC6A6 Peptide - C-terminal region
SLC6A6 Peptide - C-terminal region
Product Specifications
UniProt
E9PDM3
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC6A6 Rabbit Polyclonal Antibody (orb578952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D445887-10MG 10 mg
2,4-Difluoro-Alpha-(1H-1,2,4-triazolyl)acetophenone-d2
Sign In for Pricing
View Details 
PKSM040956-01 10 µg
Recombinant Mouse Cathepsin B/CTSB Protein (His Tag)
Sign In for Pricing
View Details PKSM040956-02 50 µg
Recombinant Mouse Cathepsin B/CTSB Protein (His Tag)
Sign In for Pricing
View Details 
BNC401960-500 1x 500 µL
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details