Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A6 Peptide - C-terminal region

SLC6A6 Peptide - C-terminal region

Product Specifications

UniProt

E9PDM3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A6 Rabbit Polyclonal Antibody (orb578952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Fluorimetric Cell Cytotoxicity Assay Kit
22782-AAT 5000 Tests

Cell Meter™ Fluorimetric Cell Cytotoxicity Assay Kit

Sign In for Pricing
View Details
GAL4 (LGALS4) Rabbit Polyclonal Antibody
AP20547PU-N 100 µg

GAL4 (LGALS4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thymidine 5’-Diphosphate Sodium Salt (~90%)
TRC-T412010-1MG 1 mg

Thymidine 5’-Diphosphate Sodium Salt (~90%)

Sign In for Pricing
View Details
Recombinant MLLT6 Antibody
RC-5805-01 50 μL

Recombinant MLLT6 Antibody

Sign In for Pricing
View Details
Recombinant MLLT6 Antibody
RC-5805-02 100 µL

Recombinant MLLT6 Antibody

Sign In for Pricing
View Details
Recombinant MLLT6 Antibody
RC-5805-03 1 mL

Recombinant MLLT6 Antibody

Sign In for Pricing
View Details