Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP10 Peptide - C-terminal region

BMP10 Peptide - C-terminal region

Product Specifications

UniProt

O95393

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP10 Rabbit Polyclonal Antibody (orb579939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055297

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A Rabbit mAb
MBS4752871-01 0.1 mL

MEF2A Rabbit mAb

Sign In for Pricing
View Details
MEF2A Rabbit mAb
MBS4752871-02 5x 0.1 mL

MEF2A Rabbit mAb

Sign In for Pricing
View Details
PKN1 Blocking Peptide
CBP1937-01 1 mg

PKN1 Blocking Peptide

Sign In for Pricing
View Details
PKN1 Blocking Peptide
CBP1937-02 5 mg

PKN1 Blocking Peptide

Sign In for Pricing
View Details
RGS4 Antibody
MBS7126248-01 0.05 mL

RGS4 Antibody

Sign In for Pricing
View Details
RGS4 Antibody
MBS7126248-02 0.1 mL

RGS4 Antibody

Sign In for Pricing
View Details