Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP10 Peptide - C-terminal region

BMP10 Peptide - C-terminal region

Product Specifications

UniProt

O95393

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP10 Rabbit Polyclonal Antibody (orb579939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055297

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat H1F0 siRNA
abx918995-01 15 nmol

Rat H1F0 siRNA

Sign In for Pricing
View Details
Rat H1F0 siRNA
abx918995-02 30 nmol

Rat H1F0 siRNA

Sign In for Pricing
View Details
ECP rabbit pAb Antibody
orb765096-01 50 μL

ECP rabbit pAb Antibody

Sign In for Pricing
View Details
ECP rabbit pAb Antibody
orb765096-02 100 µL

ECP rabbit pAb Antibody

Sign In for Pricing
View Details
CALD1 antibody
70R-16129 50 ul

CALD1 antibody

Sign In for Pricing
View Details
Lentiviral human C8orf34 shRNA (UAS) - Lentiviral human C8orf34 shRNA (UAS, GFP) plasmid
GTR15098302 1 Vial

Lentiviral human C8orf34 shRNA (UAS) - Lentiviral human C8orf34 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details