Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXK1 Peptide - C-terminal region

FOXK1 Peptide - C-terminal region

Product Specifications

UniProt

P85037

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXK1 Rabbit Polyclonal Antibody (orb580092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DC8 Antibody [DyLight 405]
NBP2-99483V 0.1 mL

Rabbit Polyclonal DC8 Antibody [DyLight 405]

Sign In for Pricing
View Details
ELISA Kit for Collagen Type III (COL3)
TRV-0052049-01 24 Tests

ELISA Kit for Collagen Type III (COL3)

Sign In for Pricing
View Details
ELISA Kit for Collagen Type III (COL3)
TRV-0052049-02 48 Tests

ELISA Kit for Collagen Type III (COL3)

Sign In for Pricing
View Details
ELISA Kit for Collagen Type III (COL3)
TRV-0052049-03 96 Tests

ELISA Kit for Collagen Type III (COL3)

Sign In for Pricing
View Details
ELISA Kit for Collagen Type III (COL3)
TRV-0052049-04 5x 96 Tests

ELISA Kit for Collagen Type III (COL3)

Sign In for Pricing
View Details
ELISA Kit for Collagen Type III (COL3)
TRV-0052049-05 10x 96 Tests

ELISA Kit for Collagen Type III (COL3)

Sign In for Pricing
View Details