Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXK1 Peptide - C-terminal region

FOXK1 Peptide - C-terminal region

Product Specifications

UniProt

P85037

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXK1 Rabbit Polyclonal Antibody (orb580092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRTN3 Antibody
orb414913-01 50 µg

PRTN3 Antibody

Sign In for Pricing
View Details
PRTN3 Antibody
orb414913-02 100 µg

PRTN3 Antibody

Sign In for Pricing
View Details
YBX1P6 Protein Lysate (Human) with C-Ha Tag
50597031 100 µg

YBX1P6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Sheep Olfactory receptor 7G2 (OR7G2) ELISA kit
GTR10438630 96 Well

Sheep Olfactory receptor 7G2 (OR7G2) ELISA kit

Sign In for Pricing
View Details
Anti-CD5 Picoband antibody
MBS1750420-01 0.01 mg

Anti-CD5 Picoband antibody

Sign In for Pricing
View Details
Anti-CD5 Picoband antibody
MBS1750420-02 0.1 mg (Carrier Free)

Anti-CD5 Picoband antibody

Sign In for Pricing
View Details