CDH19 Peptide - middle region
CDH19 Peptide - middle region
Product Specifications
UniProt
Q9H159
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDH19 Rabbit Polyclonal Antibody (orb580798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
481923 100 µL
GM2A (Ganglioside GM2 Activator, GM2 Ganglioside Activator)
Sign In for Pricing
View Details 