Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH19 Peptide - middle region

CDH19 Peptide - middle region

Product Specifications

UniProt

Q9H159

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDH19 Rabbit Polyclonal Antibody (orb580798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement 1 Inhibitor Chemiluminescent Immunoassay Kit
IHUC1INHKTC 1 Each

Human Complement 1 Inhibitor Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
Anti-Mesothelin Antibody (YP218)
T9901A-192-01 1 mg

Anti-Mesothelin Antibody (YP218)

Sign In for Pricing
View Details
Anti-Mesothelin Antibody (YP218)
T9901A-192-02 5 mg

Anti-Mesothelin Antibody (YP218)

Sign In for Pricing
View Details
N-Ethyl-N-nitroso-1-[3- (trifluoromethyl) phenyl]-2-propanamine
FE96581-01 5 mg

N-Ethyl-N-nitroso-1-[3- (trifluoromethyl) phenyl]-2-propanamine

Sign In for Pricing
View Details
N-Ethyl-N-nitroso-1-[3- (trifluoromethyl) phenyl]-2-propanamine
FE96581-02 10 mg

N-Ethyl-N-nitroso-1-[3- (trifluoromethyl) phenyl]-2-propanamine

Sign In for Pricing
View Details
N-Ethyl-N-nitroso-1-[3- (trifluoromethyl) phenyl]-2-propanamine
FE96581-03 25 mg

N-Ethyl-N-nitroso-1-[3- (trifluoromethyl) phenyl]-2-propanamine

Sign In for Pricing
View Details