Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIEZO2 Peptide - N-terminal region

PIEZO2 Peptide - N-terminal region

Product Specifications

UniProt

Q9H5I5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIEZO2 Rabbit Polyclonal Antibody (orb325498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), Biotin conjugate, 0.1mg/mL
BNCB0507-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QTRT1 Blocking Peptide
33R-3000 0.1 mg

QTRT1 Blocking Peptide

Sign In for Pricing
View Details
Keratin 26 shRNA Plasmid (m)
sc-146407-SH 20 µg

Keratin 26 shRNA Plasmid (m)

Sign In for Pricing
View Details
CD239 (BCAM) (NM_005581) Human Recombinant Protein
TP308400L 1 mg

CD239 (BCAM) (NM_005581) Human Recombinant Protein

Sign In for Pricing
View Details
FOXM1 discontinued
536423-01 30ul

FOXM1 discontinued

Sign In for Pricing
View Details
FOXM1 discontinued
536423-02 100 µL

FOXM1 discontinued

Sign In for Pricing
View Details