Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIEZO2 Peptide - N-terminal region

PIEZO2 Peptide - N-terminal region

Product Specifications

UniProt

Q9H5I5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIEZO2 Rabbit Polyclonal Antibody (orb325498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSF (D-8) : m-IgG Fc BP-HRP Bundle
sc-529263 1 Kit

PSF (D-8) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
MRP-S7 (h) -PR
sc-93971-PR 10 µM - 20 µL

MRP-S7 (h) -PR

Sign In for Pricing
View Details
MRPL21 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
30454124 3x 1.0µg DNA

MRPL21 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Ninjurin2 (NINJ2) Human shRNA Plasmid Kit (Locus ID 4815)
TR302958 1 Kit

Ninjurin2 (NINJ2) Human shRNA Plasmid Kit (Locus ID 4815)

Sign In for Pricing
View Details
Rabbit anti-Escherichia phage Phieco32 (Escherichia coli phage phi32) phi32_20 Polyclonal Antibody
MBS9017993 Inquire

Rabbit anti-Escherichia phage Phieco32 (Escherichia coli phage phi32) phi32_20 Polyclonal Antibody

Sign In for Pricing
View Details
PTPRC Antibody (PE/Cy5)
orb1250627 100 Tests

PTPRC Antibody (PE/Cy5)

Sign In for Pricing
View Details