Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH23 Peptide - N-terminal region

CDH23 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDHR23, USH1D

UniProt

A5D6V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDH23 Rabbit Polyclonal Antibody (orb580817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165403

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 GB7B,  20nm
GM-208-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 GB7B, 20nm

Sign In for Pricing
View Details
N-Carbobenzoxy-b-alanine
TRC-C176180-25G 25 g

N-Carbobenzoxy-b-alanine

Sign In for Pricing
View Details
Mouse GlUL activation kit by CRISPRa
GA201632 1 Kit

Mouse GlUL activation kit by CRISPRa

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL
BNCB2391-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3125R), CF740 conjugate, 0.1mg/mL
BNC743125-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/3125R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Coagulation Factor VIII (F8) ELISA Kit
RDR-F8-Hu-01 96 Tests

Human Coagulation Factor VIII (F8) ELISA Kit

Sign In for Pricing
View Details