Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH23 Peptide - N-terminal region

CDH23 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDHR23, USH1D

UniProt

A5D6V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDH23 Rabbit Polyclonal Antibody (orb580817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165403

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF405S conjugate, 0.1mg/mL
BNC043168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS702325 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
GLT25D2 (COLGALT2) (NM_001303421) Human Tagged ORF Clone
RG238611 10 µg

GLT25D2 (COLGALT2) (NM_001303421) Human Tagged ORF Clone

Sign In for Pricing
View Details
Polink-1 AP Rabbit Permanent Red Detection Kit
D19-110 110 mL

Polink-1 AP Rabbit Permanent Red Detection Kit

Sign In for Pricing
View Details
Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein
TP321254 20 µg

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

Sign In for Pricing
View Details
NINJ1/Ninjurin-1 Rabbit Polyclonal Antibody
HA500367 100 µL

NINJ1/Ninjurin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details