SFMBT1 Peptide - middle region
SFMBT1 Peptide - middle region
Product Specifications
UniProt
Q9UHJ3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SFMBT1 Rabbit Polyclonal Antibody (orb330611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6139550-01 0.1 mL
TNFSF13B (Tumor Necrosis Factor Ligand Superfamily Member 13B, B Lymphocyte Stimulator, BLyS, B Cell-activating Factor, BAFF, CD257, Dendritic Cell-derived TNF-like Molecule, DTL, TNF- and APOL-related Leukocyte Expressed Ligand 1, TALL1, TALL-1, THANK, T
Sign In for Pricing
View Details MBS6139550-02 5x 0.1 mL
TNFSF13B (Tumor Necrosis Factor Ligand Superfamily Member 13B, B Lymphocyte Stimulator, BLyS, B Cell-activating Factor, BAFF, CD257, Dendritic Cell-derived TNF-like Molecule, DTL, TNF- and APOL-related Leukocyte Expressed Ligand 1, TALL1, TALL-1, THANK, T
Sign In for Pricing
View Details 