SFMBT1 Peptide - middle region
SFMBT1 Peptide - middle region
Product Specifications
UniProt
Q9UHJ3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SFMBT1 Rabbit Polyclonal Antibody (orb330611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Monoclonal COX-2 Antibody (COX2/7803R) [Janelia Fluor 669]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP3-21139JF669 0.1 mL
Rabbit Monoclonal COX-2 Antibody (COX2/7803R) [Janelia Fluor 669]
Sign In for Pricing
View Details 
ARP55406_P050 100 µL
RP11-298P3.3 antibody - N-terminal region (ARP55406_P050)
Sign In for Pricing
View Details 
48832114 3x 1.0 µg
Tubgcp3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details GTR15102537 1 Vial
Lentiviral mouse H2-DMb1 shRNA (UAS) - Lentiviral mouse H2-DMb1 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details