Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND5A Peptide - N-terminal region

DENND5A Peptide - N-terminal region

Product Specifications

UniProt

B4DFB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND5A Rabbit Polyclonal Antibody (orb582664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAFIITREDGSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bence Jones lambda Protein, Human
MBS654915-01 1 mg

Bence Jones lambda Protein, Human

Sign In for Pricing
View Details
Bence Jones lambda Protein, Human
MBS654915-02 5x 1 mg

Bence Jones lambda Protein, Human

Sign In for Pricing
View Details
NR3C2 Antibody Blocking Peptide
orb1506908 500 µg

NR3C2 Antibody Blocking Peptide

Sign In for Pricing
View Details
Rabbit Monoclonal Uteroglobin/SCGB1A1 Antibody (122) [mFluor Violet 610 SE]
NBP2-90517MFV610 0.1 mL

Rabbit Monoclonal Uteroglobin/SCGB1A1 Antibody (122) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rat Pgap4 Pre-designed siRNA Set B
SI210355B 1 Each

Rat Pgap4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Human TRAF-2 Protein - (Dry Ice)
H00007186-P01-25ug 25 µg

Recombinant Human TRAF-2 Protein - (Dry Ice)

Sign In for Pricing
View Details