Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND5A Peptide - N-terminal region

DENND5A Peptide - N-terminal region

Product Specifications

UniProt

B4DFB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND5A Rabbit Polyclonal Antibody (orb582664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAFIITREDGSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYF5 Polyclonal Antibody Bio Conjugated
orb1540323 100 µL

MYF5 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Human LYPD1 Affinity Purified Polyclonal Ab
AF6855-SP 25 µg

Human LYPD1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Binder 720L ED720 Oven Convection
OVE8010 1 Each

Binder 720L ED720 Oven Convection

Sign In for Pricing
View Details
MELK Rabbit Polyclonal Antibody (Biotin)
orb2117077 100 µL

MELK Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Yeast Powder, 1 pack = 1 kg
BAL6670 1 Pack

Yeast Powder, 1 pack = 1 kg

Sign In for Pricing
View Details
SR14150
HY-121974 1 Each

SR14150

Sign In for Pricing
View Details