OR5AP2 Peptide - C-terminal region
OR5AP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR9J1
UniProt
Q8NGF4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR5AP2 Rabbit Polyclonal Antibody (orb587607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001002925
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKNKDVKKALKKILWK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![HRP Conjugated Myc tag Mouse Monoclonal Antibody [A3-B4]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea817a1/imageurl/m1405-5.webp)
M1405-5 100 µL
HRP Conjugated Myc tag Mouse Monoclonal Antibody [A3-B4]
Sign In for Pricing
View Details 
P015-568-125 1x 125 µL
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®568 Conjugate - Biotium Choice
Sign In for Pricing
View Details 
BNC740370-500 1x 500 µL
CD117 (C117/370), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472889-100 1x 100 µL
Secretory Component / ECM1 (ECM1/2889R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2038-500 1x 500 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details