Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5AP2 Peptide - C-terminal region

OR5AP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9J1

UniProt

Q8NGF4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5AP2 Rabbit Polyclonal Antibody (orb587607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002925

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKNKDVKKALKKILWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sch 58053-d4 Benzyl Ether
TRC-S199957-1MG 1 mg

Sch 58053-d4 Benzyl Ether

Sign In for Pricing
View Details
Human sCD14 Antibody Pair Set
E-KAB-0063 50 µL & 100 µg

Human sCD14 Antibody Pair Set

Sign In for Pricing
View Details
FAM157B Human Gene Knockout Kit (CRISPR)
KN427199 1 Kit

FAM157B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CFAP299 activation kit by CRISPRa
GA116811 1 Kit

Human CFAP299 activation kit by CRISPRa

Sign In for Pricing
View Details
TSEN2 (NM_001145392) Human Recombinant Protein
TP326917M 100 µg

TSEN2 (NM_001145392) Human Recombinant Protein

Sign In for Pricing
View Details
TentaGel® MB TRT-OH
MB250120.25G 25 g

TentaGel® MB TRT-OH

Sign In for Pricing
View Details