Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9G1 Peptide - C-terminal region

OR9G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9G5

UniProt

Q8NH87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR9G1 Rabbit Polyclonal Antibody (orb587608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005213

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl Bicyclo[2.2.2]phosphorothionate
TRC-B694315-4MG 4 mg

tert-Butyl Bicyclo[2.2.2]phosphorothionate

Sign In for Pricing
View Details
Rab5a Mouse Gene Knockout Kit (CRISPR)
KN514378 1 Kit

Rab5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYP7A1 (C-term) Rabbit Polyclonal Antibody
AP14901PU-N 400 µL

CYP7A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SAP97 Rabbit Polyclonal Antibody
ER2001-07 100 µL

SAP97 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein
TP720508M 50 µg

Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse DLL1/Delta-1 Protein (His Tag)
PKSM040637 100 µg

Recombinant Mouse DLL1/Delta-1 Protein (His Tag)

Sign In for Pricing
View Details