OR9G1 Peptide - C-terminal region
OR9G1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR9G5
UniProt
Q8NH87
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR9G1 Rabbit Polyclonal Antibody (orb587608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005213
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471192-500 1x 500 µL
Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2993-500 1x 500 µL
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-M0215-01 24 Tests
Mouse CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit
Sign In for Pricing
View Details