Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5B17 Peptide - C-terminal region

OR5B17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-237, OR5B20P

UniProt

Q8NGF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5B17 Rabbit Polyclonal Antibody (orb587611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005489

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-NUC Antibody
8C12168-AAT 50 µg

H-NUC Antibody

Sign In for Pricing
View Details
DL-Proline-2,5,5-d3
TRC-D756052-5MG 5 mg

DL-Proline-2,5,5-d3

Sign In for Pricing
View Details
IL3RB (CSF2RB) Rabbit Monoclonal Antibody [Clone ID: BION-1]
TA386178 200 µg

IL3RB (CSF2RB) Rabbit Monoclonal Antibody [Clone ID: BION-1]

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF568 conjugate, 0.1mg/mL
BNC682386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ahsa1 Mouse Gene Knockout Kit (CRISPR)
KN501014 1 Kit

Ahsa1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(E)-Sacubitril Maleic Acid
TRC-S809385-100MG 100 mg

(E)-Sacubitril Maleic Acid

Sign In for Pricing
View Details