Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5B17 Peptide - C-terminal region

OR5B17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-237, OR5B20P

UniProt

Q8NGF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5B17 Rabbit Polyclonal Antibody (orb587611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005489

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWOX Recombinant Rabbit monoclonal Antibody
HA751558 100 µL

WWOX Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SALL4 Mouse Monoclonal Antibody [A9G10]
HA601145 100 µL

SALL4 Mouse Monoclonal Antibody [A9G10]

Sign In for Pricing
View Details
Mb (NM_013593) Mouse Tagged ORF Clone
MG201129 10 µg

Mb (NM_013593) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CT45A6 (NM_001017438) Human Over-expression Lysate
LC422735 20 µg

CT45A6 (NM_001017438) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560141 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
SH3KBP1 Polyclonal Antibody
E-AB-67392-01 60 µL

SH3KBP1 Polyclonal Antibody

Sign In for Pricing
View Details