Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5V1 Peptide - C-terminal region

OR5V1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6M1-21, hs6M1-21

UniProt

Q9UGF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5V1 Rabbit Polyclonal Antibody (orb587612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110503

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Esophagus
CS605529 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
hsa-miR-4693-5p miRNA Agomir
MBS8312213-01 5 nmol

hsa-miR-4693-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4693-5p miRNA Agomir
MBS8312213-02 10 nmol

hsa-miR-4693-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4693-5p miRNA Agomir
MBS8312213-03 20 nmol

hsa-miR-4693-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4693-5p miRNA Agomir
MBS8312213-04 5x 20 nmol

hsa-miR-4693-5p miRNA Agomir

Sign In for Pricing
View Details
RGD1563669 Protein Vector (Rat) (pPB-N-His)
PV300755 500 ng

RGD1563669 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details