Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5V1 Peptide - C-terminal region

OR5V1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6M1-21, hs6M1-21

UniProt

Q9UGF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5V1 Rabbit Polyclonal Antibody (orb587612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110503

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAP2K3 (S218) Antibody
A11029-50UG 50 µg

Phospho-MAP2K3 (S218) Antibody

Sign In for Pricing
View Details
Picrocrocin
sc-479341 1 mg

Picrocrocin

Sign In for Pricing
View Details
Anti-Alpha-Fetoprotein (AFP) Monoclonal Antibody
TRV-0019948-01 50 Tests

Anti-Alpha-Fetoprotein (AFP) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Alpha-Fetoprotein (AFP) Monoclonal Antibody
TRV-0019948-02 100 Tests

Anti-Alpha-Fetoprotein (AFP) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Alpha-Fetoprotein (AFP) Monoclonal Antibody
TRV-0019948-03 200 Tests

Anti-Alpha-Fetoprotein (AFP) Monoclonal Antibody

Sign In for Pricing
View Details
LRP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1230608 1.0 µg DNA

LRP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details