Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5D14 Peptide - C-terminal region

OR5D14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-141, OR11-150

UniProt

Q8NGL3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5D14 Rabbit Polyclonal Antibody (orb587614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004735

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CBR3 Antibody (OTI1G6) [PerCP]
NBP2-70343PCP 0.1 mL

Mouse Monoclonal CBR3 Antibody (OTI1G6) [PerCP]

Sign In for Pricing
View Details
Rabbit Polyclonal RTVP-1/GLIPR1 Antibody [DyLight 488]
NBP2-99206G 0.1 mL

Rabbit Polyclonal RTVP-1/GLIPR1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Lentiviral human PAH sgRNA gene knockout kit - Lentiviral human PAH sgRNA gene knockout kit (plasmid)
GTR15358379 1 Vial

Lentiviral human PAH sgRNA gene knockout kit - Lentiviral human PAH sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CYP7B1, Control Peptide (Cytochrome P450 7B1, 25-hydroxycholesterol 7-alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase)
147814 100 µg

CYP7B1, Control Peptide (Cytochrome P450 7B1, 25-hydroxycholesterol 7-alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase)

Sign In for Pricing
View Details
N-Acetyl-D-mannosamine
C09351 25 mg

N-Acetyl-D-mannosamine

Sign In for Pricing
View Details
Human Protein KPLCE (KPLCE) ELISA Kit
abx553716 96 Tests

Human Protein KPLCE (KPLCE) ELISA Kit

Sign In for Pricing
View Details