Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5D14 Peptide - C-terminal region

OR5D14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-141, OR11-150

UniProt

Q8NGL3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5D14 Rabbit Polyclonal Antibody (orb587614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004735

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB-4 (m) -PR
sc-141291-PR 10 µM - 20 µL

ASB-4 (m) -PR

Sign In for Pricing
View Details
Rno-miR-103-3p miRNA Agomir
CMS0091-01 5 nmol

Rno-miR-103-3p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-103-3p miRNA Agomir
CMS0091-02 10 nmol

Rno-miR-103-3p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-103-3p miRNA Agomir
CMS0091-03 20 nmol

Rno-miR-103-3p miRNA Agomir

Sign In for Pricing
View Details
APOA2 Rabbit Polyclonal Antibody
MBS9513394-01 0.05 mL

APOA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APOA2 Rabbit Polyclonal Antibody
MBS9513394-02 0.1 mL

APOA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details