Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5T2 Peptide - C-terminal region

OR5T2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-177

UniProt

Q8NGG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5T2 Rabbit Polyclonal Antibody (orb587615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSSSYASDHDMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit
MBS7203332-01 48 Well

Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit

Sign In for Pricing
View Details
Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit
MBS7203332-02 96 Well

Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit

Sign In for Pricing
View Details
Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit
MBS7203332-03 5x 96 Well

Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit

Sign In for Pricing
View Details
Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit
MBS7203332-04 10x 96 Well

Bovine Cell cycle exit and neuronal differentiation protein 1 (CEND1) ELISA Kit

Sign In for Pricing
View Details
3- (4-Methylphenyl) -5- (trifluoromethyl) pyrazole
284410-01 100 mg

3- (4-Methylphenyl) -5- (trifluoromethyl) pyrazole

Sign In for Pricing
View Details
3- (4-Methylphenyl) -5- (trifluoromethyl) pyrazole
284410-02 250 mg

3- (4-Methylphenyl) -5- (trifluoromethyl) pyrazole

Sign In for Pricing
View Details