Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5T2 Peptide - C-terminal region

OR5T2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-177

UniProt

Q8NGG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5T2 Rabbit Polyclonal Antibody (orb587615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSSSYASDHDMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-DNA Ligase IV/LIG4 Polyclonal Antibody
PAV6700 100 μL

Rabbit Anti-DNA Ligase IV/LIG4 Polyclonal Antibody

Sign In for Pricing
View Details
DLL3 (NM_016941) Human 3' UTR Clone
SC206408 10 µg

DLL3 (NM_016941) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant VRK1 protein
MBS389153-01 0.02 mg

Recombinant VRK1 protein

Sign In for Pricing
View Details
Recombinant VRK1 protein
MBS389153-02 1 mg

Recombinant VRK1 protein

Sign In for Pricing
View Details
Recombinant VRK1 protein
MBS389153-03 5x 1 mg

Recombinant VRK1 protein

Sign In for Pricing
View Details
CERK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV622588 1.0 µg DNA

CERK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details