OR8D1 Peptide - C-terminal region
OR8D1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
JCG9, OR8D3, OST004, PDJ9J14
UniProt
Q8WZ84
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR8D1 Rabbit Polyclonal Antibody (orb587616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001002917
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0199-20D 1 mL
Keratin 17 (Keratin Type I Cytoskeletal 17, Keratin-17, K17, KRT17, 39.1, Cytokeratin-17, CK-17, PC, PC2, PCHC1) discontinued
Sign In for Pricing
View Details 
LS050859-20ug 20 µg
SPOCK3 (NM_001040159) Human Over-expression Lysate
Sign In for Pricing
View Details GTR15293386 1 Vial
Lentiviral mouse Slc4a5 shRNA (UAS) - Lentiviral mouse Slc4a5 shRNA (UAS) plasmid
Sign In for Pricing
View Details